PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Tp2g11950
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassicaceae incertae sedis; Schrenkiella
Family GATA
Protein Properties Length: 486aa    MW: 54541.3 Da    PI: 6.1015
Description GATA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Tp2g11950genomethellungiellaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GATA50.13.8e-16741135
       GATA  1 CsnCgttkTplWRrgpdgnktLCnaCGlyyrkkgl 35
               C +Cg+t+TplWR+gp  ++ LCnaCG ++r kg+
  Tp2g11950  7 CYHCGVTSTPLWRNGPPEKPVLCNACGSRWRTKGT 41
               ****************88888***********997 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004012.0E-10155IPR000679Zinc finger, GATA-type
SuperFamilySSF577168.55E-12546No hitNo description
CDDcd002026.53E-18663No hitNo description
Gene3DG3DSA:3.30.50.101.2E-12741IPR013088Zinc finger, NHR/GATA-type
PROSITE patternPS003440732IPR000679Zinc finger, GATA-type
PROSITE profilePS5011411.2740IPR000679Zinc finger, GATA-type
PfamPF003206.2E-14741IPR000679Zinc finger, GATA-type
PfamPF139191.5E-9244335IPR028020ASX homology domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0008270Molecular Functionzinc ion binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 486 aa     Download sequence    Send to blast
MGKQGPCYHC GVTSTPLWRN GPPEKPVLCN ACGSRWRTKG TLVNYTPLHA RAEGDEIEIE  60
DHKAQKMMMI KGMPVNKKIP KRKSYQENFT VKRTNLEFSN GFKMKALDEE ASNRSSSGSV  120
VSNSESCDQS NAWETTFPCK KRTCVGRPKA ASSVEKLTKD LYSILQEQQS SCLSGSSEED  180
LLFENESPMV IGHGSVLMRD PHSGAREEES EASSLLVESS KSSSTHSIYR GQRSLNFGGK  240
AIKQEQLKRT KSQVLGRQGL PLCNIDLKDV FNFDEFIEKF TEEEQQKLMK LLPEVDSVDR  300
PDSLGSMFES SQFKENFSLF QQLVADGVFE TSSSTSSSGS KLEDFKRLAK LALSDPNKSH  360
LLESYRMLKE QRKEIEDSVT TTSKGSIPNP SSNRRLVTIE RPCESLNQNF SETRVVMKSP  420
KEVMRIRSKH METEEIIENS VSSFEPMSYS GSMAFSYEDN DISDQDLLLD VPSNGSFPQA  480
ELLHMI
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0202590.0BT020259.1 Arabidopsis thaliana At5g47140 gene, complete cds.
GenBankBT0204500.0BT020450.1 Arabidopsis thaliana At5g47140 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010494936.10.0PREDICTED: GATA transcription factor 27 isoform X1
SwissprotQ5PP380.0GAT27_ARATH; GATA transcription factor 27
TrEMBLD7MPX30.0D7MPX3_ARALL; Zinc finger family protein
STRINGfgenesh1_pg.C_scaffold_80000660.0(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM16062785
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G47140.10.0GATA transcription factor 27